PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT20961
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 262aa    MW: 30767.2 Da    PI: 6.5192
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT20961genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.61.2e-07117159145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      r +W++ + +l++++ +q+G++ ++ I + ++  +++ q++ ++ 
         EMT20961 117 RAKWSKSDTDLFYQGLHQFGSD-FAMIQQLFP-DKSRDQVRQKFK 159
                      569*******************.*********.*********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.08E-10108165IPR009057Homeodomain-like
PfamPF159633.2E-25110190No hitNo description
Gene3DG3DSA:1.10.10.603.8E-4115163IPR009057Homeodomain-like
PROSITE profilePS512939.554115166IPR017884SANT domain
SMARTSM007176.6E-8116164IPR001005SANT/Myb domain
CDDcd001673.38E-5119160No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MKDTLTEQPE KKLTHRIRQK RAKVSEVKTL LEKPDHEIDR MKLSVMHIRL LHEARERIKS  60
KTIPSGPSSF NQSSSQFGDT NSFDPFEENY DNGRRENHMV ENATKLNYHS YMNKQTRAKW  120
SKSDTDLFYQ GLHQFGSDFA MIQQLFPDKS RDQVRQKFKT EEKKHPMQVH DAILHRSRDN  180
LYLKQVIKQL NIEDLQRDIN STHKQVVASI EGDTGNEDFM EEENDSNWSA KELSARQSEV  240
REVEHVAGNA DDGLDLDVFD WY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2500790.0AK250079.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf66i09, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014756811.11e-133PREDICTED: LOW QUALITY PROTEIN: transcription factor TFIIIB component B''-like
TrEMBLM8CCV00.0M8CCV0_AEGTA; Transcription factor TFIIIB component B
STRINGBRADI1G35190.11e-125(Brachypodium distachyon)
STRINGBRADI3G11036.11e-128(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25952946
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.12e-33MYB_related family protein